Anti-MADCAM1

Anti-MADCAM1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4529 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Mucosal Vascular Addressin Cell Adhesion... more
Product information "Anti-MADCAM1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Mucosal Vascular Addressin Cell Adhesion Molecule 1 is a protein that in humans is encoded by the MADCAM1 gene. By PCR-based analysis of somatic cell hybrids, Leung et al.(1997) mapped the gene to chromosome 19. The protein encoded by this gene is an endothelil cell adhesion molecule that interacts preferentially with the leukocyte beta7 integrin LPAM-1(alpha4 / beta7), L-selectin, and VLA-4(alpha4/beta1) on myeloid cells to direct leukocytes into mucosal and inflamed tissues. It is a member of the immunoglobulin superfamily and is similar to ICAM-1 and VCAM-1. Protein function: Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes. Isoform 2, lacking the mucin-like domain, may be specialized in supporting integrin alpha-4/beta-7-dependent adhesion strengthening, independent of L- selectin binding. [The UniProt Consortium]
Keywords: Anti-MADCAM1, Anti-MAdCAM-1, Anti-hMAdCAM-1, Anti-Mucosal addressin cell adhesion molecule 1, MADCAM1 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4529

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids QELEGAQALGPEVQEEEEEPQGDEDVLFRVTERWRL
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MADCAM1"
Write a review
or to review a product.
Viewed