Anti-LY6E (Lymphocyte Antigen 6E, Ly-6E, Retinoic Acid-induced Gene E Protein, RIG-E, Stem Cell Anti

Applications: , Suitable for use in Western Blot. Other applications have not been tested. Recommended Dilutions: Western Blot: 1ug/ml, Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFSAADGGLRASVTLLGAGLLLSLLPALLRFGP, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.