Anti-LOX-1 / OLR1 (Middle Region)

Anti-LOX-1 / OLR1 (Middle Region)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32862 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. OLR1 (oxidized low density lipoprotein... more
Product information "Anti-LOX-1 / OLR1 (Middle Region)"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. OLR1 (oxidized low density lipoprotein (lectin-like) receptor 1) also called CLEC8A, LOX-1, SCARE1, is a receptor protein which belongs to the C-type lectin superfamily. The OLR1 gene encodes a cell-surface endocytosis receptor for oxidized low density lipoprotein (OxLDL). This gene is mapped on 12p13.2. Incubation of the cells with LDL had no effect on LOX1 expression, but incubation with OxLDL resulted in a dose-dependent increase in LOX1 mRNA and protein expression, however, very high concentrations of OxLDL caused a decrease in OxLDL expression, perhaps indicating toxic effects on endothelial cells. LOX1 was also expressed in macrophages, but not in vascular smooth muscle cells. The findings suggested a role for LOX1 in the pathophysiology of atherosclerotic cardiovascular disease. LOX1 expression was detected in all choroidal neovascular membranes, regardless of structure, whereas there was no evidence of LOX1 within the posterior segments of normal eyes. LOX1 plays an active role in the pathogenesis of choroidal neovascularization, especially in ARMD. Protein function: Receptor that mediates the recognition, internalization and degradation of oxidatively modified low density lipoprotein (oxLDL) by vascular endothelial cells. OxLDL is a marker of atherosclerosis that induces vascular endothelial cell activation and dysfunction, resulting in pro-inflammatory responses, pro- oxidative conditions and apoptosis. Its association with oxLDL induces the activation of NF-kappa-B through an increased production of intracellular reactive oxygen and a variety of pro- atherogenic cellular responses including a reduction of nitric oxide (NO) release, monocyte adhesion and apoptosis. In addition to binding oxLDL, it acts as a receptor for the HSP70 protein involved in antigen cross-presentation to naive T-cells in dendritic cells, thereby participating in cell-mediated antigen cross-presentation. Also involved in inflammatory process, by acting as a leukocyte-adhesion molecule at the vascular interface in endotoxin-induced inflammation. Also acts as a receptor for advanced glycation end (AGE) products, activated platelets, monocytes, apoptotic cells and both Gram-negative and Gram- positive bacteria. [The UniProt Consortium]
Keywords: Anti-OLR1, Anti-CLEC8A, LOX-1 Antibody / OLR1 (Middle Region)
Supplier: NSJ Bioreagents
Supplier-Nr: R32862

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids 162-197 (SFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISY) were used as the immunogen for the LOX-1 antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-LOX-1 / OLR1 (Middle Region)"
Write a review
or to review a product.
Viewed