Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| NSJ-RQ4423 | 100 µg | - | - |
7 - 12 business days* |
790.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. LIM domain only 2 (Rhombotin-like 1,... more
Product information "Anti-LMO2 / Rhombotin 2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. LIM domain only 2 (Rhombotin-like 1, Rhombotin 2), also known as LMO2, RBTNL1, RBTN2, RHOM2, TTG2, and T-Cell Translocation Protein 2, is a protein which in humans is encoded by the LMO2 gene. LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms. Protein function: Acts with TAL1/SCL to regulate red blood cell development. Also acts with LDB1 to maintain erythroid precursors in an immature state. [The UniProt Consortium]
| Keywords: | Anti-LMO2, Anti-RBTN2, Anti-LMO-2, Anti-Rhombotin-2, Anti-LIM domain only protein 2, Anti-Cysteine-rich protein TTG-2, Anti-T-cell translocation protein 2, LMO2 Antibody / Rhombotin 2 |
| Supplier: | NSJ Bioreagents |
| Supplier-Nr: | RQ4423 |
Properties
| Application: | WB |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
| Immunogen: | Amino acids QKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI from the human protein were used as the immunogen for the LMO2 antibody. |
| Format: | Purified |
Database Information
| KEGG ID : | K15612 | Matching products |
| UniProt ID : | P25791 | Matching products |
| Gene ID : | GeneID 4005 | Matching products |
Handling & Safety
| Storage: | +4°C |
| Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed