Anti-LMO2 / Rhombotin 2

Anti-LMO2 / Rhombotin 2
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4423 100 µg - -

7 - 12 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. LIM domain only 2 (Rhombotin-like 1,... more
Product information "Anti-LMO2 / Rhombotin 2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. LIM domain only 2 (Rhombotin-like 1, Rhombotin 2), also known as LMO2, RBTNL1, RBTN2, RHOM2, TTG2, and T-Cell Translocation Protein 2, is a protein which in humans is encoded by the LMO2 gene. LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms. Protein function: Acts with TAL1/SCL to regulate red blood cell development. Also acts with LDB1 to maintain erythroid precursors in an immature state. [The UniProt Consortium]
Keywords: Anti-LMO2, Anti-RBTN2, Anti-LMO-2, Anti-Rhombotin-2, Anti-LIM domain only protein 2, Anti-Cysteine-rich protein TTG-2, Anti-T-cell translocation protein 2, LMO2 Antibody / Rhombotin 2
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4423

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids QKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI from the human protein were used as the immunogen for the LMO2 antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-LMO2 / Rhombotin 2"
Write a review
or to review a product.
Viewed