Anti-LMO2 (LIM Domain only 2 (rhombotin-like 1), RBTN2, RBTNL1, RHOM2, TTG2)

Anti-LMO2 (LIM Domain only 2 (rhombotin-like 1), RBTN2, RBTNL1, RHOM2, TTG2)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
248224.100 100 µg - -

3 - 19 business days*

850.00€
 
LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac... more
Product information "Anti-LMO2 (LIM Domain only 2 (rhombotin-like 1), RBTN2, RBTNL1, RHOM2, TTG2)"
LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms, Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 248224

Properties

Application: ELISA, WB
Antibody Type: Monoclonal
Clone: 4D3
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: LMO2 (NP_005565, 16aa-102aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Format: Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-LMO2 (LIM Domain only 2 (rhombotin-like 1), RBTN2, RBTNL1, RHOM2, TTG2)"
Write a review
or to review a product.
Viewed