Anti-LIMK1

Anti-LIMK1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG40707.50 50 µg - -

10 - 15 business days*

551.00€
 
Protein function: Serine/threonine-protein kinase that plays an essential role in the regulation... more
Product information "Anti-LIMK1"
Protein function: Serine/threonine-protein kinase that plays an essential role in the regulation of actin filament dynamics. Acts downstream of several Rho family GTPase signal transduction pathways. Activated by upstream kinases including ROCK1, PAK1 and PAK4, which phosphorylate LIMK1 on a threonine residue located in its activation loop. LIMK1 subsequently phosphorylates and inactivates the actin binding/depolymerizing factors cofilin-1/CFL1, cofilin- 2/CFL2 and destrin/DSTN, thereby preventing the cleavage of filamentous actin (F-actin), and stabilizing the actin cytoskeleton. In this way LIMK1 regulates several actin-dependent biological processes including cell motility, cell cycle progression, and differentiation. Phosphorylates TPPP on serine residues, thereby promoting microtubule disassembly. Stimulates axonal outgrowth and may be involved in brain development. Isoform 3 has a dominant negative effect on actin cytoskeletal changes. Required for atypical chemokine receptor ACKR2-induced phosphorylation of cofilin (CFL1). [The UniProt Consortium]
Keywords: Anti-LIMK, Anti-LIMK1, Anti-LIMK-1, EC=2.7.11.1, Anti-LIM domain kinase 1
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG40707

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Synthetic peptide corresponding to aa. 599-634 of Human LIMK1 (KLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRR)
MW: 73 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-LIMK1"
Write a review
or to review a product.
Viewed