Anti-LGMN (PRSC1, Legumain, Asparaginyl Endopeptidase, Protease, Cysteine 1)

Anti-LGMN (PRSC1, Legumain, Asparaginyl Endopeptidase, Protease, Cysteine 1)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
129076.100 100 µg - -

9 - 20 business days*

850.00€
 
This gene encodes a cysteine protease that has a strict specificity for hydrolysis of asparaginyl... more
Product information "Anti-LGMN (PRSC1, Legumain, Asparaginyl Endopeptidase, Protease, Cysteine 1)"
This gene encodes a cysteine protease that has a strict specificity for hydrolysis of asparaginyl bonds. This enzyme may be involved in the processing of bacterial peptides and endogenous proteins for MHC class II presentation in the lysosomal/endosomal systems. Enzyme activation is triggered by acidic pH and appears to be autocatalytic. Protein expression occurs after monocytes differentiate into dendritic cells. A fully mature, active enzyme is produced following lipopolysaccharide expression in mature dendritic cells. Overexpression of this gene may be associated with the majority of solid tumor types. This gene has a pseudogene on chromosome 13. Several alternatively spliced transcript variants have been described, but the biological validity of only two has been determined. These two variants encode the same isoform. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MVWKVAVFLSVALGIGAIPIDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIVVMMYDDIAYSEDNPTPGIVINRPNGTDVYQGVPKDYTGEDVTPQNFLAVLRGDAEAVKGIGSGKVLKSGPQDHVFIYFTDHGS TGILVFPNEDLHVKDLNETIHYMYKHKMYRKMVFYIEACESGSMMNHLPD, NINVYATTAANPRESSYACYYDEKRSTYLGDWYSVNWMEDSDVEDLTKET, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 129076

Properties

Application: ELISA
Antibody Type: Monoclonal
Clone: M1
Conjugate: No
Host: Mouse
Species reactivity: human
Format: Affinity Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-LGMN (PRSC1, Legumain, Asparaginyl Endopeptidase, Protease, Cysteine 1)"
Write a review
or to review a product.
Viewed