Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| NSJ-R31981 | 100 µg | - | - |
3 - 10 business days* |
790.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. LCAT (Lecithin: Cholesterol... more
Product information "Anti-LCAT"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. LCAT (Lecithin: Cholesterol Acyltransferase), is an enzyme that converts free cholesterol into cholesteryl ester. Azoulay et al. (1987) used a cDNA clone corresponding to LCAT to assign the locus to 16q22 through the analysis of DNA from somatic cell hybrids and in situ hybridization. LCAT plays an important role in lipoprotein metabolism, especially in the process termed 'reverse cholesterol transport.' The enzyme is synthesized in the liver and circulates in blood plasma as a complex with components of high density lipoprotein (HDL). Cholesterol from peripheral cells is transferred to HDL particles, esterified through the action of LCAT on HDL, and incorporated into the core of the lipoprotein. The cholesterol ester is thereby transported to the liver (Jonas, 2000). Protein function: Central enzyme in the extracellular metabolism of plasma lipoproteins. Synthesized mainly in the liver and secreted into plasma where it converts cholesterol and phosphatidylcholines (lecithins) to cholesteryl esters and lysophosphatidylcholines on the surface of high and low density lipoproteins (HDLs and LDLs) (PubMed:19065001). The cholesterol ester is then transported back to the liver. Also produced in the brain by primary astrocytes, and esterifies free cholesterol on nascent APOE-containing lipoproteins secreted from glia and influences cerebral spinal fluid (CSF) APOE- and APOA1 levels (PubMed:19065001). Together with APOE and the cholesterol transporter ABCA1, plays a key role in the maturation of glial-derived, nascent lipoproteins (PubMed:19065001). Required for remodeling high-density lipoprotein particles into their spherical forms (PubMed:19065001). Has a preference for plasma 16:0-18:2 or 18:O- 18:2 phosphatidylcholines (PubMed:8820107). [The UniProt Consortium]
| Keywords: | Anti-Lcat, Anti-Lecithin-cholesterol acyltransferase, Anti-Phospholipid-cholesterol acyltransferase, Anti-Phosphatidylcholine-sterol acyltransferase, LCAT Antibody |
| Supplier: | NSJ Bioreagents |
| Supplier-Nr: | R31981 |
Properties
| Application: | WB |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
| Immunogen: | Amino acids QPVHLLPMNETDHLNMVFSNKTLEHINAILLGAYR of mouse LCAT were used as the immunogen for the LCAT antibody. |
| Format: | Purified |
Database Information
| KEGG ID : | K00650 | Matching products |
| UniProt ID : | P16301 | Matching products |
| Gene ID : | GeneID 16816 | Matching products |
Handling & Safety
| Storage: | -20°C |
| Shipping: | -20°C (International: -20°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed