Anti-Lactoperoxidase

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ6775 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Lactoperoxidase is a peroxidase enzyme... more
Product information "Anti-Lactoperoxidase"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Lactoperoxidase is a peroxidase enzyme secreted from mammary, salivary and other mucosal glands including the lungs, bronchii and nose that functions as a natural and the first line of defense against antibacterial and antiviral agents. Lactoperoxidase is a member of the heme peroxidase family of enzymes. In humans, lactoperoxidase is encoded by the LPO gene. This gene encodes a member of the peroxidase family of proteins. The encoded preproprotein is proteolytically processed to generate the mature enzyme. Following its secretion from salivary, mammary, and other mucosal glands, this enzyme catalyzes the generation of the antimicrobial substance hypothiocyanous acid. This gene is present in a gene cluster on chromosome 17. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. Protein function: Heme-containing oxidoreductase which catalyzes the conversion of thiocyanate (SCN(-)) into antimicrobial agent hypothiocyanous acid (OSCN(-)) in the presence of hydrogen peroxide (H2O2). Also involved in the conversion of iodide (I(-)) into hypoiodite (IO(-)) in the presence of H2O2. Responsible for the inactivation of a wide range of micro-organisms and hence, important component of defense mechanism (PubMed:12626341). Shows antibacterial properties against Pseudomonas aeruginosa (PubMed:12626341). The lactoperoxidase-SCN(-)-H2O2 system shows antibacterial properties against Burkholderia cepacia and Haemophilus influenzae in vitro (PubMed:12626341). Present in mammary and salivary gland secretions and may contribute to airway host defense against infection (PubMed:12626341). May contribute to maintaining an appropriate H2O2 cellular level, therefore protecting cells from H2O2-caused injuries and inflammation. [The UniProt Consortium]
Keywords: Anti-LPO, Anti-SPO, Anti-SAPX, Anti-Lactoperoxidase, Anti-Salivary peroxidase, Lactoperoxidase Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ6775

Properties

Application: WB, IF
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids MFRLDENYQPWGPEPELPLHTLFFNTWRMVKD from the human protein
Format: Cellular & Oxid. Stress

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Lactoperoxidase"
Write a review
or to review a product.
Viewed