Anti-L1CAM / NCAM-L1 / CD171

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4172 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. L1, also known as L1CAM, is a... more
Product information "Anti-L1CAM / NCAM-L1 / CD171"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. L1, also known as L1CAM, is a transmembrane protein member of the L1 protein family, encoded by the L1CAM gene. The protein encoded by this gene is an axonal glycoprotein belonging to the immunoglobulin supergene family. The ectodomain, consisting of several immunoglobulin-like domains and fibronectin-like repeats (type III), is linked via a single transmembrane sequence to a conserved cytoplasmic domain. This cell adhesion molecule plays an important role in nervous system development, including neuronal migration and differentiation. Mutations in the gene cause X-linked neurological syndromes known as CRASH (corpus callosum hypoplasia, retardation, aphasia, spastic paraplegia and hydrocephalus). Alternative splicing of this gene results in multiple transcript variants, some of which include an alternate exon that is considered to be specific to neurons. Protein function: Neural cell adhesion molecule involved in the dynamics of cell adhesion and in the generation of transmembrane signals at tyrosine kinase receptors. During brain development, critical in multiple processes, including neuronal migration, axonal growth and fasciculation, and synaptogenesis. In the mature brain, plays a role in the dynamics of neuronal structure and function, including synaptic plasticity. [The UniProt Consortium]
Keywords: Anti-L1CAM, Anti-CD171, Anti-CAML1, Anti-NCAM-L1, Anti-N-CAM-L1, Anti-Neural cell adhesion molecule L1, L1CAM Antibody / NCAM-L1 / CD171
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4172

Properties

Application: IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids NMVITWKPLRWMDWNAPQVQYRVQWRPQGTRGPW were used as the immunogen for the L1CAM antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-L1CAM / NCAM-L1 / CD171"
Write a review
or to review a product.
Viewed