Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
NSJ-R31952 | 100 µg | - | - |
3 - 10 business days* |
755.00€
|
0.5mg/ml if reconstituted with 0.2ml sterile DI water. XRCC6 (X-Ray Repair, Complementing... more
Product information "Anti-Ku70 / XRCC6"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. XRCC6 (X-Ray Repair, Complementing Defective, In Chinese Hamster, 6), also called Ku70, G22P1 or TLAA, is a protein that in humans, is encoded by the XRCC6 gene. In addition, the XRCC6 gene encodes subunit p70 of the p70/p80 autoantigen which consists of 2 proteins of molecular mass of approximately 70,000 and 80,000 daltons that dimerize to form a 10 S DNA-binding complex. The XRCC6 gene is mapped to 22q13.2. XRCC6 and Mre11 are differentially expressed during meiosis. XRCC6 interacts with Baxa, a mediator of mitochondrial-dependent apoptosis. Disruption of both FANCC and XRCC6 suppressed sensitivity to crosslinking agents, diminished chromosome breaks, and reversed defective homologous recombination. Ku70 binds directly to free DNA ends, committing them to NHEJ repair. In early meiotic prophase, however, when meiotic recombination is most probably initiated, Mre11 was abundant, whereas XRCC6 was not detectable. Protein function: Single-stranded DNA-dependent ATP-dependent helicase. Has a role in chromosome translocation. The DNA helicase II complex binds preferentially to fork-like ends of double-stranded DNA in a cell cycle-dependent manner. It works in the 3'-5' direction. Binding to DNA may be mediated by XRCC6. Involved in DNA non-homologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination. The XRCC5/6 dimer acts as regulatory subunit of the DNA-dependent protein kinase complex DNA-PK by increasing the affinity of the catalytic subunit PRKDC to DNA by 100-fold. The XRCC5/6 dimer is probably involved in stabilizing broken DNA ends and bringing them together. The assembly of the DNA-PK complex to DNA ends is required for the NHEJ ligation step. Required for osteocalcin gene expression. Probably also acts as a 5'-deoxyribose-5-phosphate lyase (5'-dRP lyase), by catalyzing the beta-elimination of the 5' deoxyribose- 5-phosphate at an abasic site near double-strand breaks. 5'-dRP lyase activity allows to 'clean' the termini of abasic sites, a class of nucleotide damage commonly associated with strand breaks, before such broken ends can be joined. The XRCC5/6 dimer together with APEX1 acts as a negative regulator of transcription. [The UniProt Consortium]
Keywords: | Anti-Ku70, Anti-TLAA, Anti-CTC75, Anti-XRCC6, Anti-G22P1, Anti-CTCBF, EC=3.6.4.-, EC=4.2.99.-, Anti-5'-dRP lyase Ku70, Anti-DNA repair protein XRCC6, Anti-Thyroid-lupus autoantigen, Anti-70 kDa subunit of Ku antigen, Anti-Lupus Ku autoantigen protein p70, |
Supplier: | NSJ Bioreagents |
Supplier-Nr: | R31952 |
Properties
Application: | WB, IHC (paraffin) |
Antibody Type: | Polyclonal |
Conjugate: | No |
Host: | Rabbit |
Species reactivity: | human |
Immunogen: | Amino acids AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD of human Ku70 were used as the immunogen for the Ku70 antibody. |
Format: | Purified |
Database Information
KEGG ID : | K10884 | Matching products |
UniProt ID : | P12956 | Matching products |
Gene ID | GeneID 2547 | Matching products |
Handling & Safety
Storage: | -20°C |
Shipping: | -20°C (International: -20°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed