Anti-KLRC1 (Killer Cell Lectin-like Receptor Subfamily C Member 1, CD159 Antigen-like Family Member

Anti-KLRC1 (Killer Cell Lectin-like Receptor Subfamily C Member 1, CD159 Antigen-like Family Member
Item number Size Datasheet Manual SDS Delivery time Quantity Price
128899.100 100 µg - -

3 - 19 business days*

850.00€
 
Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and... more
Product information "Anti-KLRC1 (Killer Cell Lectin-like Receptor Subfamily C Member 1, CD159 Antigen-like Family Member"
Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor family, also called NKG2 family, which is a group of transmembrane proteins preferentially expressed in NK cells. This family of proteins is characterized by the type II membrane orientation and the presence of a C-type lectin domain. This protein forms a complex with another family member, KLRD1/CD94, and has been implicated in the recognition of the MHC class I HLA-E molecules in NK cells. The genes of NKG2 family members form a killer cell lectin-like receptor gene cluster on chromosome 12. Four alternatively spliced transcript variants encoding two distinct isoforms have been observed. Applications: Suitable for use in ELISA and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDNQGVIYSDLNLPPNPKRQQRKPKGNKSSILATEQEITYAELNLQKASQDFQGNDKTYHCKDLPSAPEK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 128899

Properties

Application: ELISA, IP
Antibody Type: Monoclonal
Clone: 2C3
Conjugate: No
Host: Mouse
Species reactivity: human
Format: Affinity Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-KLRC1 (Killer Cell Lectin-like Receptor Subfamily C Member 1, CD159 Antigen-like Family Member"
Write a review
or to review a product.
Viewed