Anti-KLF4

Anti-KLF4
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4437 100 µg - -

7 - 12 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Kruppel-like factor 4, also known as EZF... more
Product information "Anti-KLF4"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Kruppel-like factor 4, also known as EZF or GKLF, is a protein that in humans is encoded by the KLF4 gene. This gene is mapped to 9q31.2. KLF4 gene encodes a member of the Kruppel family of transcription factors. This gene plays an important role in maintaining embryonic stem cells, and in preventing their differentiation. It is required for establishing the barrier function of the skin and for postnatal maturation and maintenance of the ocular surface. This gene involved in the differentiation of epithelial cells and may also function in skeletal and kidney development. Protein function: Transcription factor, can act both as activator and as repressor. Binds the 5'-CACCC-3' core sequence. Binds to the promoter region of its own gene and can activate its own transcription. Regulates the expression of key transcription factors during embryonic development. Plays an important role in maintaining embryonic stem cells, and in preventing their differentiation. Required for establishing the barrier function of the skin and for postnatal maturation and maintenance of the ocular surface. Involved in the differentiation of epithelial cells and may also function in skeletal and kidney development. Contributes to the down-regulation of p53/TP53 transcription. [The UniProt Consortium]
Keywords: Anti-EZF, Anti-KLF4, Anti-Krueppel-like factor 4, Anti-Gut-enriched krueppel-like factor, Anti-Epithelial zinc finger protein EZF, KLF4 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4437

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids EKTLRQAGAPNNRWREELSHMKRLPPVLPGRPYDLA
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-KLF4"
Write a review
or to review a product.
Viewed