Anti-Kininogen 1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG40932.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: (1) Kininogens are inhibitors of thiol proteases, (2) HMW-kininogen plays an... more
Product information "Anti-Kininogen 1"
Protein function: (1) Kininogens are inhibitors of thiol proteases, (2) HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII, (3) HMW-kininogen inhibits the thrombin- and plasmin- induced aggregation of thrombocytes, (4) the active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects: (4A) influence in smooth muscle contraction, (4B) induction of hypotension, (4C) natriuresis and diuresis, (4D) decrease in blood glucose level, (4E) it is a mediator of inflammation and causes (4E1) increase in vascular permeability, (4E2) stimulation of nociceptors (4E3) release of other mediators of inflammation (e.g. prostaglandins), (4F) it has a cardioprotective effect (directly via bradykinin action, indirectly via endothelium-derived relaxing factor action), (5) LMW-kininogen inhibits the aggregation of thrombocytes, (6) LMW- kininogen is in contrast to HMW-kininogen not involved in blood clotting. [The UniProt Consortium]
Keywords: Anti-Kng, Anti-Kng1
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG40932

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: mouse
Immunogen: Synthetic peptide corresponding to aa. 227-259 of Mouse Kininogen 1. (ECRGNLFMDINNKIANFSQSCTLYSGDDLVEAL)
MW: 73 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Kininogen 1"
Write a review
or to review a product.
Viewed