Anti-Keratocan

Anti-Keratocan
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31830 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Keratocan (KTN), also known as keratan... more
Product information "Anti-Keratocan"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Keratocan (KTN), also known as keratan sulfate proteoglycan keratocan, is a protein that in humans is encoded by the KERA gene. It is mapped to 12q22. The protein encoded by this gene is a keratan sulfate proteoglycan that is involved in corneal transparency. Defects in this gene are a cause of autosomal recessive cornea plana 2 (CNA2). Keratan sulfate proteoglycans (KSPGs) are members of the small leucine-rich proteoglycan (SLRP) family. KSPGs, particularly keratocan, lumican and mimecan, are important to the transparency of the cornea. Protein function: May be important in developing and maintaining corneal transparency and for the structure of the stromal matrix. [The UniProt Consortium]
Keywords: Anti-KTN, Anti-KERA, Anti-SLRR2B, Anti-Keratocan, Anti-Keratan sulfate proteoglycan keratocan, Keratocan Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R31830

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse
Immunogen: Amino acids YLQNNLIETIPEKPFENATQLRWINLNKNKITN of human Keratocan were used as the immunogen for the Keratocan antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Keratocan"
Write a review
or to review a product.
Viewed