Anti-Keratocan

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59334.50	50 µg		-	-	6 - 14 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: May be important in developing and maintaining corneal transparency and for the... more

Close menu

Product information "Anti-Keratocan"

Protein function: May be important in developing and maintaining corneal transparency and for the structure of the stromal matrix. [The UniProt Consortium]

Keywords:	Anti-KTN, Anti-KERA, Anti-SLRR2B, Anti-Keratocan, Anti-Keratan sulfate proteoglycan keratocan
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59334

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse (Expected: bovine)
Immunogen:	Synthetic peptide corresponding to aa. 77-109 of Human Keratocan. (YLQNNLIETIPEKPFENATQLRWINLNKNKITN)
MW:	41 kD
Format:	Antigen Affinity Purified