Anti-KCNH1 (C-Terminal Region)

Anti-KCNH1 (C-Terminal Region)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4065 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Potassium voltage-gated channel subfamily... more
Product information "Anti-KCNH1 (C-Terminal Region)"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Potassium voltage-gated channel subfamily H member 1 is a protein that in humans is encoded by the KCNH1 gene. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit of a voltage-gated non-inactivating delayed rectifier potassium channel. It is activated at the onset of myoblast differentiation. The gene is highly expressed in brain and in myoblasts. Overexpression of the gene may confer a growth advantage to cancer cells and favor tumor cell proliferation. Alternative splicing of this gene results in two transcript variants encoding distinct isoforms. Protein function: Pore-forming (alpha) subunit of a voltage-gated delayed rectifier potassium channel (PubMed:9738473, PubMed:11943152, PubMed:10880439, PubMed:22732247, PubMed:25556795, PubMed:27325704, PubMed:27005320, PubMed:27618660). Channel properties are modulated by subunit assembly (PubMed:11943152). Mediates IK(NI) current in myoblasts (PubMed:9738473). Involved in the regulation of cell proliferation and differentiation, in particular adipogenic and osteogenic differentiation in bone marrow-derived mesenchymal stem cells (MSCs) (PubMed:23881642). [The UniProt Consortium]
Keywords: Anti-KCNH1, Anti-hEAG1, Anti-h-eag, Anti-EAG channel 1, Anti-Ether-a-go-go potassium channel 1, Anti-Voltage-gated potassium channel subunit Kv10.1, Anti-Potassium voltage-gated channel subfamily H member 1, KCNH1 Antibody (C-Terminal Region)
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4065

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids AKRKSWARFKDACGKSEDWNKVSKAESMETLPERTKA from the human protein were used as the immunogen for the KCNH1 antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-KCNH1 (C-Terminal Region)"
Write a review
or to review a product.
Viewed