Anti-KChIP2

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59333.50	50 µg		-	-	6 - 14 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating... more

Close menu

Product information "Anti-KChIP2"

Protein function: Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Modulates channel density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND2/Kv4.2 and KCND3/Kv4.3 currents. Involved in KCND2 and KCND3 trafficking to the cell surface. May be required for the expression of I(To) currents in the heart. [The UniProt Consortium]

Keywords:	Anti-KCHIP2, Anti-KChIP2, Anti-KCNIP2, Anti-Kv channel-interacting protein 2, Anti-Potassium channel-interacting protein 2, Anti-A-type potassium channel modulatory protein 2, Anti-Cardiac voltage-gated potassium channel modulatory subunit
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59333

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat (Expected: chicken)
Immunogen:	Synthetic peptide corresponding to aa. 78-112 of Human KChIP2. (DEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYR)
MW:	31 kD
Format:	Antigen Affinity Purified