Anti-Kallikrein 4 (Kallikrein-4, Enamel Matrix Serine Proteinase 1, Kallikrein-like Protein 1, KLK-L

Kallikreins are a subgroup of serine proteases and are implicated in carcinogenesis. A novel Kallikrein gene Prostase/KLK-L1 (also known as KLK4) is expressed and is up-regulated by androgens and progestins. KLK-L1 may be involved in the pathogenesis and/or progression of prostate, breast, and possibly other malignancies. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GRMPTVLQCVNVSVVSEEVCSKLYDPLYHPSMFCAGGGQDQKDSCNGDSGGPLICNGYLQGLVSFGKAPCGQVGVPGVYTNLCKFTEWIEKTVQAS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.