Anti-ITGA4 (Integrin alpha-4, CD49 Antigen-like Family Member D, Integrin alpha-IV, VLA-4 Subunit al

Anti-ITGA4 (Integrin alpha-4, CD49 Antigen-like Family Member D, Integrin alpha-IV, VLA-4 Subunit al
Item number Size Datasheet Manual SDS Delivery time Quantity Price
128626.100 100 µg - -

9 - 20 business days*

850.00€
 
ITGA4s are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain.... more
Product information "Anti-ITGA4 (Integrin alpha-4, CD49 Antigen-like Family Member D, Integrin alpha-IV, VLA-4 Subunit al"
ITGA4s are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. It belongs to the integrin alpha chain family of proteins. The gene of this protein encodes an alpha 4 chain. Unlike other integrin alpha chains, alpha 4 neither contains an I-domain, nor undergoes disulfide-linked cleavage. Alpha 4 chain associates with either beta 1 chain or beta 7 chain. CD14 is a novel ligand for alpha4beta1, exhibiting similar activation-state dependent binding characteristics as other alpha4beta1 ligands. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GESVDAANFIQLDDLECHFQPINITLQVYNTGPSTLPGSSVSISFPNRLSSGGAEMFHVQEMVVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTKSGR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 128626

Properties

Application: ELISA, WB
Antibody Type: Monoclonal
Clone: 3E4
Conjugate: No
Host: Mouse
Species reactivity: human
Format: Affinity Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ITGA4 (Integrin alpha-4, CD49 Antigen-like Family Member D, Integrin alpha-IV, VLA-4 Subunit al"
Write a review
or to review a product.
Viewed