Anti-IRF9

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59246.50	50 µl		-	-	6 - 14 business days*		584.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Transcription factor that mediates signaling by type I IFNs (IFN-alpha and... more

Close menu

Product information "Anti-IRF9"

Protein function: Transcription factor that mediates signaling by type I IFNs (IFN-alpha and IFN-beta). Following type I IFN binding to cell surface receptors, Jak kinases (TYK2 and JAK1) are activated, leading to tyrosine phosphorylation of STAT1 and STAT2. IRF9/ISGF3G associates with the phosphorylated STAT1:STAT2 dimer to form a complex termed ISGF3 transcription factor, that enters the nucleus. ISGF3 binds to the IFN stimulated response element (ISRE) to activate the transcription of interferon stimulated genes, which drive the cell in an antiviral state. [The UniProt Consortium]

Keywords:	Anti-IRF9, Anti-IRF-9, Anti-ISGF3G, Anti-ISGF-3 gamma, Anti-ISGF3 p48 subunit, Anti-Interferon regulatory factor 9, Anti-Interferon-stimulated gene factor 3 gamma, Anti-Transcriptional regulator ISGF3 subunit gamma
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59246

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: mouse, rat, bovine, dog, guinea pig, horse, rabbit, zebrafish)
Immunogen:	Synthetic peptide around the N-terminal region of Human IRF9. (within the following region: PWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNK)
MW:	44 kD
Format:	Affinity Purified