Anti-IRF8

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG40961.50 50 µl - -

6 - 14 business days*

584.00€
 
Protein function: Plays a role as a transcriptional activator or repressor (PubMed:25122610).... more
Product information "Anti-IRF8"
Protein function: Plays a role as a transcriptional activator or repressor (PubMed:25122610). Specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)). Plays a negative regulatory role in cells of the immune system. Involved in CD8(+) dendritic cell differentiation by forming a complex with the BATF-JUNB heterodimer in immune cells, leading to recognition of AICE sequence (5'-TGAnTCA/GAAA-3'), an immune-specific regulatory element, followed by cooperative binding of BATF and IRF8 and activation of genes. Positively regulates macroautophagy in dendritic cells (PubMed:29434592). [The UniProt Consortium]
Keywords: Anti-IRF8, Anti-ICSBP, Anti-IRF-8, Anti-ICSBP1, Anti-H-ICSBP, Anti-Interferon regulatory factor 8, Anti-Interferon consensus sequence-binding protein
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG40961

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: mouse, rat, cow, dog, guinea pig, horse, rabbit, zebrafish)
Immunogen: Synthetic peptide around the N-terminal region of Human IRF8. (within the following region: MFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRC)
MW: 48 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-IRF8"
Write a review
or to review a product.
Viewed