Anti-IRF5

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32219 100 µg - -

3 - 10 business days

503.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Interferon regulatory factor 5, also... more
Product information "Anti-IRF5"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Interferon regulatory factor 5, also called IRF5 or SLEB10, is a protein that in humans is encoded by the IRF5 gene. This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Protein function: Transcription factor involved in the induction of interferons IFNA and INFB and inflammatory cytokines upon virus infection. Activated by TLR7 or TLR8 signaling. [The UniProt Consortium]
Keywords: Anti-IRF5, Anti-IRF-5, Anti-Interferon regulatory factor 5, IRF5 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32219

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Host: Rabbit
Reactivity: Human, Mouse, Rat
Immunogen: Amino acids RLQISNPDLKDRMVEQFKELHHIWQSQQRLQ of human IRF5 were used as the immunogen for the IRF5 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-IRF5"
Write a review
or to review a product.
Viewed