Anti-Involucrin

Anti-Involucrin
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31905 100 µg - -

7 - 12 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Involucrin is a protein component of human... more
Product information "Anti-Involucrin"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Involucrin is a protein component of human skin and in humans is encoded by the IVL gene. It is a highly reactive, soluble, transglutaminase substrate protein present in keratinocytes of epidermisand other stratified squamous epithelia. It first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase thus helping in the formation of an insoluble envelope beneath the plasma membrane functioning as a glutamyl donor during assembly of the cornified envelope. Additionally, Involucrin is synthesised in the stratum spinosum and cross linked in the stratum granulosum by the transglutaminase enzyme that makes it highly stable. Thus it provides structural support to the cell, thereby allowing the cell to resist invasion by micro-organisms. Protein function: Part of the insoluble cornified cell envelope (CE) of stratified squamous epithelia. [The UniProt Consortium]
Keywords: Anti-IVL, Anti-Involucrin, Involucrin Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R31905

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids QVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK of human Involucrin were used as the immunogen for the Involucrin antibody.
Format: Purified

Database Information

UniProt ID : P07476 | Matching products
Gene ID : GeneID 3713 | Matching products

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Involucrin"
Write a review
or to review a product.
Viewed