Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| NSJ-R32348 | 100 µg | - | - |
7 - 12 business days* |
790.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Inhibitor of growth protein 1 is a protein... more
Product information "Anti-ING1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Inhibitor of growth protein 1 is a protein that in humans is encoded by the ING1 gene. It is mapped to 13q34. This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. Protein function: Cooperates with p53/TP53 in the negative regulatory pathway of cell growth by modulating p53-dependent transcriptional activation. Implicated as a tumor suppressor gene. [The UniProt Consortium]
| Keywords: | Anti-ING1, Anti-Inhibitor of growth protein 1, ING1 Antibody |
| Supplier: | NSJ Bioreagents |
| Supplier-Nr: | R32348 |
Properties
| Application: | WB |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | human |
| Immunogen: | Amino acids KELDECYERFSRETDGAQKRRMLHCVQRALIR of human Inhibitor of growth protein 1 were used as the immunogen for the ING1 antibody. |
| Format: | Purified |
Database Information
| KEGG ID : | K19197 | Matching products |
| UniProt ID : | Q9UK53 | Matching products |
| Gene ID : | GeneID 3621 | Matching products |
Handling & Safety
| Storage: | -20°C |
| Shipping: | -20°C (International: -20°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed