Anti-IL7R / CD127

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32384 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. The interleukin-7 receptor, also known as... more
Product information "Anti-IL7R / CD127"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. The interleukin-7 receptor, also known as IL7R alpha, is a protein found on the surface of cells. It is mapped to 5p13. Interleukin-7 receptor has been shown to play a critical role in the development of immune cells called lymphocytes - specifically in a process known as V(D)J recombination. This protein is also found to control the accessibility of a region of the genome that contains the T-cell receptor gamma gene, by STAT5 and histone acetylation. Knockout studies in mice suggest that blocking apoptosis is an essential function of this protein during differentiation and activation of T lymphocytes. Functional defects in this protein may be associated with the pathogenesis of severe combined immunodeficiency (SCID). Protein function: Receptor for interleukin-7. Also acts as a receptor for thymic stromal lymphopoietin (TSLP). [The UniProt Consortium]
Keywords: Anti-IL7R, Anti-CD127, Anti-IL-7RA, Anti-CDw127, Anti-IL-7R-alpha, Anti-IL-7R subunit alpha, Anti-IL-7 receptor subunit alpha, Anti-Interleukin-7 receptor subunit alpha, IL7R Antibody / CD127
Supplier: NSJ Bioreagents
Supplier-Nr: R32384

Properties

Application: WB, FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ from IL7R alpha
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-IL7R / CD127"
Write a review
or to review a product.
Viewed