Anti-IL28RA

Anti-IL28RA
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG41102.50 50 µl - -

10 - 15 business days*

584.00€
 
Protein function: The IFNLR1/IL10RB dimer is a receptor for the cytokine ligands IFNL2 and IFNL3... more
Product information "Anti-IL28RA"
Protein function: The IFNLR1/IL10RB dimer is a receptor for the cytokine ligands IFNL2 and IFNL3 and mediates their antiviral activity. The ligand/receptor complex stimulate the activation of the JAK/STAT signaling pathway leading to the expression of IFN-stimulated genes (ISG), which contribute to the antiviral state. Determines the cell type specificity of the lambda interferon action. Shows a more restricted pattern of expression in the epithelial tissues thereby limiting responses to lambda interferons primarily to epithelial cells of the respiratory, gastrointestinal, and reproductive tracts. Seems not to be essential for early virus- activated host defense in vaginal infection, but plays an important role in Toll-like receptor (TLR)-induced antiviral defense. Plays a significant role in the antiviral immune defense in the intestinal epithelium. [The UniProt Consortium]
Keywords: Anti-LICR2, Anti-IL28RA, Anti-IFNLR1, Anti-CRF2-12, Anti-IL-28RA, Anti-IL-28R-alpha, Anti-IFN-lambda-R1, Anti-IFN-lambda receptor 1, Anti-Interferon lambda receptor 1, Anti-IL-28 receptor subunit alpha, Anti-Cytokine receptor family 2 member 12
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG41102

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: mouse, rat, cow, dog, guinea pig, horse, rabbit)
Immunogen: Synthetic peptide around the N-terminal region of Human IL28RA. (within the following region: EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF)
MW: 58 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-IL28RA"
Write a review
or to review a product.
Viewed