Anti-IL-22

Anti-IL-22
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32874 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Interleukin-22 (IL-22), also known as... more
Product information "Anti-IL-22"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Interleukin-22 (IL-22), also known as ILTIF, is protein that in humans is encoded by the IL22 gene. IL-22 a member of a group of cytokines called the IL-10 family or IL-10 superfamily, a class of potent mediators of cellular inflammatory responses. Using FISH, the IL22 gene is mapped to chromosome 12q15, close to the IFNG and the herpesvirus saimiri-induced AK155 genes. IL-22 can contribute to immune disease through the stimulation of inflammatory responses, S100s and defensins. It also promotes hepatocyte survival in the liver and epithelial cells in the lung and gut similar to IL-10. In some contexts, the pro-inflammatory versus tissue-protective functions of IL-22 are regulated by the often co-expressed cytokine IL-17A. Protein function: Cytokine that contributes to the inflammatory response in vivo. [The UniProt Consortium]
Keywords: Anti-IL22, Anti-IL-22, Anti-ILTIF, Anti-IL-TIF, Anti-Interleukin-22, Anti-Cytokine Zcyto18, Anti-IL-10-related T-cell-derived-inducible factor, IL-22 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32874

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids DDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNA were used as the immunogen for the IL-22 antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-IL-22"
Write a review
or to review a product.
Viewed