Anti-IGFBP2

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG10674.50	50 µg		-	-	6 - 14 business days*		559.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Inhibits IGF-mediated growth and developmental rates. IGF-binding proteins... more

Close menu

Product information "Anti-IGFBP2"

Protein function: Inhibits IGF-mediated growth and developmental rates. IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. [The UniProt Consortium]

Keywords:	Anti-BP2, Anti-IBP-2, Anti-IGFBP2, Anti-IGFBP-2, Anti-IGF-binding protein 2, Anti-Insulin-like growth factor-binding protein 2
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG10674

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, rat
Immunogen:	Synthetic peptide corresponding to the sequence at a.a 228-257 (QQELDQVLERISTMRLPDERGPLEHLYSLH) around the C-terminus of human IGFBP2 protein
Format:	Antigen Affinity Purified