Anti-Igf2r / M6pr

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4576 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Insulin-like growth factor 2 receptor,... more
Product information "Anti-Igf2r / M6pr"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Insulin-like growth factor 2 receptor, also called IGF2R or I-MPR is a protein that in humans is encoded by the IGF2R gene. This gene is mapped to 6q25.3. This gene encodes a receptor for both insulin-like growth factor 2 and mannose 6-phosphate, although the binding sites for either are located on different segments of the receptor. This receptor functions in the intracellular trafficking of lysosomal enzymes, the activation of transforming growth factor beta, and the degradation of insulin-like growth factor 2. While the related mouse gene shows exclusive expression from the maternal allele, imprinting of the human gene appears to be polymorphic, with only a minority of individuals showing expression from the maternal allele. Protein function: Acts as a positive regulator of T-cell coactivation, by binding DPP4. Transport of phosphorylated lysosomal enzymes from the Golgi complex and the cell surface to lysosomes. Lysosomal enzymes bearing phosphomannosyl residues bind specifically to mannose-6-phosphate receptors in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelyosomal compartment where the low pH mediates the dissociation of the complex. This receptor also binds IGF2. [The UniProt Consortium]
Keywords: Anti-M6PR, Anti-Igf2r, Anti-CD222, Anti-CI-MPR, Anti-MPR 300, Anti-M6P/IGF2R, Anti-IGF-II receptor, Anti-M6P/IGF2 receptor, Anti-CI Man-6-P receptor, Anti-300 kDa mannose 6-phosphate receptor, Anti-Insulin-like growth factor 2 receptor, Igf2r Antibody / M
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4576

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: mouse, rat
Immunogen: Amino acids EKARKGKFRPGQRKPTAPAKLVSFHDDSDEDLLH
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Igf2r / M6pr"
Write a review
or to review a product.
Viewed