Anti-IDH1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31836 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Isocitrate dehydrogenase 1 (NADP+),... more
Product information "Anti-IDH1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Isocitrate dehydrogenase 1 (NADP+), soluble is an enzyme that in humans is encoded by the IDH1 gene. Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
Keywords: Anti-IDH, Anti-IDP, Anti-PICD, Anti-IDH1, Anti-NADP(+)-specific ICDH, Anti-Oxalosuccinate decarboxylase, Anti-Cytosolic NADP-isocitrate dehydrogenase, Anti-Isocitrate dehydrogenase [NADP] cytoplasmic, IDH1 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R31836

Properties

Application: WB, IHC (paraffin), (IF), ICC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK of human IDH1
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-IDH1"
Write a review
or to review a product.
Viewed