Anti-ICA1

Anti-ICA1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32190 100 µg - -

3 - 10 business days

503.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Islet cell autoantigen 1 is a protein that... more
Product information "Anti-ICA1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Islet cell autoantigen 1 is a protein that in humans is encoded by the ICA1 gene. It is mapped to 7p22. This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. WhatÆs more, this protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene. Protein function: May play a role in neurotransmitter secretion. [The UniProt Consortium]
Keywords: Anti-p69, Anti-ICA1, Anti-ICA69, Anti-ICAp69, Anti-Islet cell autoantigen 1, Anti-Islet cell autoantigen p69, Anti-69 kDa islet cell autoantigen, ICA1 Antibody
Supplier-Nr: R32190

Properties

Application: WB
Antibody Type: Polyclonal
Host: Rabbit
Reactivity: Human, Mouse, Rat
Immunogen: Amino acids EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK of human ICA1 were used as the immunogen for the ICA1 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ICA1"
Write a review
or to review a product.
Viewed