Anti-IBSP / Bone Sialoprotein

Anti-IBSP / Bone Sialoprotein
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG58797.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: Binds tightly to hydroxyapatite. Appears to form an integral part of the... more
Product information "Anti-IBSP / Bone Sialoprotein"
Protein function: Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction. Promotes Arg-Gly-Asp-dependent cell attachment. [The UniProt Consortium]
Keywords: Anti-BNSP, Anti-IBSP, Anti-BSP II, Anti-Bone sialoprotein 2, Anti-Bone sialoprotein II, Anti-Cell-binding sialoprotein, Anti-Integrin-binding sialoprotein
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG58797

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Synthetic peptide corresponding to a sequence of Human IBSP (FSMKNLHRRVKIEDSEENGVFKYRPRYYLYKHAYFYPHLKRFPVQ)
MW: 35 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-IBSP / Bone Sialoprotein"
Write a review
or to review a product.
Viewed