Anti-HtrA3

Anti-HtrA3
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32751 100 µg - -

7 - 12 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Human HtrA3 protease, which induces... more
Product information "Anti-HtrA3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Human HtrA3 protease, which induces mitochondria-mediated apoptosis, can be a tumor suppressor and a potential therapeutic target in the treatment of cancer. It may also have a role in ovarian development, granulosa cell differentiation and luteinization. The long isoform, HTRA3L, contains 453 amino acids and has a predicted molecular mass of 49 kD. It contains an N-terminal signal peptide, followed by an insulin/IGF (see 147440)-binding domain, a Kazal-type S protease inhibitor domain, a trypsin protease domain, and a PDZ domain. The short isoform, HTRA3S, contains 357 amino acids and has a predicted molecular mass of 38 kD. Protein function: Serine protease that cleaves beta-casein/CSN2 as well as several extracellular matrix (ECM) proteoglycans such as decorin/DCN, biglycan/BGN and fibronectin/FN1. Inhibits signaling mediated by TGF-beta family proteins possibly indirectly by degradation of these ECM proteoglycans. May act as a tumor suppressor. Negatively regulates, in vitro, trophoblast invasion during placental development and may be involved in the development of the placenta in vivo. May also have a role in ovarian development, granulosa cell differentiation and luteinization (PubMed:21321049, PubMed:22229724). [The UniProt Consortium]
Keywords: Anti-PRSP, Anti-HTRA3, EC=3.4.21.-, Anti-Serine protease HTRA3, Anti-Pregnancy-related serine protease, Anti-High-temperature requirement factor A3, HtrA3 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32751

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids 330-362 (FAIPSDRITRFLTEFQDKQIKDWKKRFIGIRMR) from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-HtrA3"
Write a review
or to review a product.
Viewed