Anti-HSPA2

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32139 100 µg - -

3 - 10 business days

503.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. HSPA2 (heat shock 70kDa protein 2) is also... more
Product information "Anti-HSPA2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. HSPA2 (heat shock 70kDa protein 2) is also known as HEAT-SHOCK PROTEIN, 70-KD, 2, HSP70-2, HEAT-SHOCK PROTEIN, 70-KD, 3 or HSP70-3. Analysis of the sequence indicated that HSPA2 is the human homolog of the murine Hsp70-2 gene, with 91.7% identity in the nucleotide coding sequence and 98.2% in the corresponding amino acid sequence. HSPA2 has less amino acid homology to the other members of the human HSP70 gene family. HSPA2 is constitutively expressed in most tissues, with very high levels in testis and skeletal muscle. The HSPA2 gene is located on chromosome 14q22-q24. Immunohistochemical analysis detected weak expression of HSPA2 in spermatocytes and stronger expression in spermatids and in the tail of mature sperm. HSPA2 may be critical to sperm maturation through its role as a protein chaperone. Protein function: In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage. Plays a role in spermatogenesis. In association with SHCBP1L may participate in the maintenance of spindle integrity during meiosis in male germ cells. [The UniProt Consortium]
Keywords: Anti-HSPA2, Anti-Heat shock 70 kDa protein 2, Anti-Heat shock-related 70 kDa protein 2, HSPA2 Antibody
Supplier-Nr: R32139

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Host: Rabbit
Reactivity: Human, Mouse, Rat
Immunogen: Amino acids KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK of human HSPA2 were used as the immunogen for the HSPA2 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-HSPA2"
Write a review
or to review a product.
Viewed