Anti-HRH1 (Histamine H1 Receptor, H1R, HH1R)

Anti-HRH1 (Histamine H1 Receptor, H1R, HH1R)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
H5090-09A.100 100 µg - -

3 - 19 business days*

850.00€
 
Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like... more
Product information "Anti-HRH1 (Histamine H1 Receptor, H1R, HH1R)"
Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by histamine receptors H1, H2, H3 and H4. This gene was thought to be intronless until recently. The protein encoded by this gene is an integral membrane protein and belongs to the G protein-coupled receptor superfamily. It mediates the contraction of smooth muscles, the increase in capillary permeability due to contraction of terminal venules, the release of catecholamine from adrenal medulla, and neurotransmission in the central nervous system. Multiple alternatively spliced variants, encoding the same protein, have been identified. Applications: Suitable for use in ELISA. Other applications have not been tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Keywords: Anti-Histamine H1 receptor
Supplier: United States Biological
Supplier-Nr: H5090-09A

Properties

Application: ELISA
Antibody Type: Monoclonal
Clone: 3D1
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: HRH1 (NP_000852, 312-415aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-HRH1 (Histamine H1 Receptor, H1R, HH1R)"
Write a review
or to review a product.
Viewed