Anti-HRAS (v-Ha-ras Harvey rat Sarcoma Viral Oncogene Homolog, C-BAS/HAS, C-H-RAS, C-HA-RAS1, CTLO,

Anti-HRAS (v-Ha-ras Harvey rat Sarcoma Viral Oncogene Homolog, C-BAS/HAS, C-H-RAS, C-HA-RAS1, CTLO,
Item number Size Datasheet Manual SDS Delivery time Quantity Price
247251.50 50 µl - -

3 - 19 business days*

850.00€
 
This gene belongs to the Ras oncogene family, whose members are related to the transforming genes... more
Product information "Anti-HRAS (v-Ha-ras Harvey rat Sarcoma Viral Oncogene Homolog, C-BAS/HAS, C-H-RAS, C-HA-RAS1, CTLO,"
This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, mental retardation, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated in a variety of cancers, including bladder cancer, follicular thyroid cancer, and oral squamous cell carcinoma. Multiple transcript variants, which encode different isoforms, have been identified for this gene. [provided by RefSeq, Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 247251

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: HRAS (AAH95471.1, 1aa-189aa) full-length human protein.
Format: Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-HRAS (v-Ha-ras Harvey rat Sarcoma Viral Oncogene Homolog, C-BAS/HAS, C-H-RAS, C-HA-RAS1, CTLO,"
Write a review
or to review a product.
Viewed