Anti-HOXB9

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG41602.50 50 µl - -

6 - 14 business days*

584.00€
 
Protein function: Sequence-specific transcription factor which is part of a developmental... more
Product information "Anti-HOXB9"
Protein function: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. [The UniProt Consortium]
Keywords: Anti-HOXB9, Anti-HOX2E, Anti-Homeobox protein Hox-B9, Anti-Homeobox protein Hox-2E, Anti-Homeobox protein Hox-2.5
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG41602

Properties

Application: IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: mouse, rat, cow, dog, horse, swine, rabbit)
Immunogen: Synthetic peptide around the N-terminal region of Human HOXB9. (within the following region: SPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAV)
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-HOXB9"
Write a review
or to review a product.
Viewed