Anti-HOXB5

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59650.50	50 µl		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Sequence-specific transcription factor which is part of a developmental... more

Close menu

Product information "Anti-HOXB5"

Protein function: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. [The UniProt Consortium]

Keywords:	Anti-HOXB5, Anti-HOX2A, Anti-Homeobox protein Hu-1, Anti-Homeobox protein Hox-2A, Anti-Homeobox protein Hox-B5, Anti-Homeobox protein HHO.C10
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59650

Properties

Application:	IHC (paraffin)
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: mouse, rat, bovine, dog, guinea pig, horse, rabbit)
Immunogen:	Synthetic peptide around the N-terminal region of Human HOXB5. (within the following region: MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYN)
MW:	30 kD
Format:	Affinity Purified