Anti-hnRNP H

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58940.50	50 µl		-	-	6 - 14 business days*		584.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: This protein is a component of the heterogeneous nuclear ribonucleoprotein... more

Close menu

Product information "Anti-hnRNP H"

Protein function: This protein is a component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes which provide the substrate for the processing events that pre-mRNAs undergo before becoming functional, translatable mRNAs in the cytoplasm. Mediates pre-mRNA alternative splicing regulation. Inhibits, together with CUGBP1, insulin receptor (IR) pre-mRNA exon 11 inclusion in myoblast. Binds to the IR RNA. Binds poly(RG). [The UniProt Consortium]

Keywords:	Anti-HNRPH, Anti-HNRNPH1
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58940

Properties

Application:	ICC, IF, IHC (paraffin), IP, WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: mouse, rat, bovine, dog, guinea pig, horse, rabbit)
Immunogen:	Synthetic peptide around the middle region of Human hnRNP H. (within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG)
MW:	49 kD
Format:	Affinity Purified