Anti-HNF1B

Anti-HNF1B
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32080 100 µg - -

7 - 12 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. HNF1 homeobox B (hepatocyte nuclear factor... more
Product information "Anti-HNF1B"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. HNF1 homeobox B (hepatocyte nuclear factor 1 homeobox B), also known as HNF1B or transcription factor 2 (TCF2), is a human gene. It is a member of the homeodomain-containing superfamily of transcription factors. This gene is mapped to 17q12. The HNF1B protein is believed to form heterodimers with another liver-specific member of this transcription factor family, TCF1. HNF1B functions as both a classic transcriptional activator and as a bookmarking factor that marks target genes for rapid transcriptional reactivation after mitosis. HNF1B also can regulate renal tubulogenesis by controlling expression of SOC3. Mutation of HNF1B that disrupts normal function has been identified as the cause of MODY5 (Maturity-Onset of Diabetes, Type 5). Protein function: Transcription factor, probably binds to the inverted palindrome 5'-GTTAATNATTAAC-3'. [The UniProt Consortium]
Keywords: Anti-TCF2, Anti-HNF1B, Anti-vHNF1, Anti-TCF-2, Anti-HNF-1B, Anti-HNF-1-beta, Anti-Homeoprotein LFB3, Anti-Transcription factor 2, Anti-Hepatocyte nuclear factor 1-beta, Anti-Variant hepatic nuclear factor 1, HNF1B Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32080

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat
Immunogen: Amino acids AQQPFMAAVTQLQNSHMYAHKQEPPQYSHT of human HNF1 beta were used as the immunogen for the HNF1 beta antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-HNF1B"
Write a review
or to review a product.
Viewed