Anti-HMGB3 / HMG4

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31810 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. High-mobility group protein B, also known... more
Product information "Anti-HMGB3 / HMG4"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. High-mobility group protein B, also known as HMG4, is a protein that in humans is encoded by the HMGB3 gene. This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants. Protein function: Multifunctional protein with various roles in different cellular compartments. May act in a redox sensitive manner. Associates with chromatin and binds DNA with a preference to non- canonical DNA structures such as single-stranded DNA. Can bent DNA and enhance DNA flexibility by looping thus providing a mechanism to promote activities on various gene promoters. Proposed to be involved in the innate immune response to nucleic acids by acting as a cytoplasmic promiscuous immunogenic DNA/RNA sensor. Negatively regulates B-cell and myeloid cell differentiation. In hematopoietic stem cells may regulate the balance between self-renewal and differentiation. Involved in negative regulation of canonical Wnt signaling. [The UniProt Consortium]
Keywords: Anti-HMG-4, Anti-HMG2A, Anti-HMGB3, Anti-HMG-2a, Anti-High mobility group protein 4, Anti-High mobility group protein 2a, Anti-High mobility group protein B3, HMGB3 Antibody / HMG4
Supplier: NSJ Bioreagents
Supplier-Nr: R31810

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR of human HMG4 were used as the immunogen for the HMG4 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-HMGB3 / HMG4"
Write a review
or to review a product.
Viewed