Anti-HES1 (Hairy and Enhancer of Split 1, HES-1, bHLHb39, Class B Basic Helix-loop-helix Protein 39,

Anti-HES1 (Hairy and Enhancer of Split 1, HES-1, bHLHb39, Class B Basic Helix-loop-helix Protein 39,
Item number Size Datasheet Manual SDS Delivery time Quantity Price
127811.100 100 µg - -

3 - 19 business days*

699.00€
 
HES1 is a transcriptional repressor of genes that require a bHLH protein for their transcription.... more
Product information "Anti-HES1 (Hairy and Enhancer of Split 1, HES-1, bHLHb39, Class B Basic Helix-loop-helix Protein 39,"
HES1 is a transcriptional repressor of genes that require a bHLH protein for their transcription. It may act as a negative regulator of myogenesis by inhibiting the functions of MYOD1 and ASH1. HES1 is expressed in developing neuroectodermal and endodermal endocrine tissues, and HES1 deficient embryos show severe defects in neuronal development, as well as pancreatic hypoplasia. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 127811

Properties

Application: ELISA, WB
Antibody Type: Monoclonal
Clone: 4D9
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: Partial recombinant corresponding to aa36-142 from human HES1 (NP_005515) with GST tag. MW of the GST tag alone is 26kD.
Purity: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-HES1 (Hairy and Enhancer of Split 1, HES-1, bHLHb39, Class B Basic Helix-loop-helix Protein 39,"
Write a review
or to review a product.
Viewed