Anti-HCN2

Anti-HCN2
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32802 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Potassium/sodium... more
Product information "Anti-HCN2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated ion channel 2 is a protein that in humans is encoded by the HCN2 gene. The HCN2 gene is localized on human chromosome 19p13.3 and contains eight exons spanning approximately 27 kb. Hyperpolarization-activated cation channels of the HCN gene family, such as HCN2, contribute to spontaneous rhythmic activity in both heart and brain. Protein function: Hyperpolarization-activated ion channel exhibiting weak selectivity for potassium over sodium ions. Contributes to the native pacemaker currents in heart (If) and in neurons (Ih). Can also transport ammonium in the distal nephron. Produces a large instantaneous current. Modulated by intracellular chloride ions and pH, acidic pH shifts the activation to more negative voltages. [The UniProt Consortium]
Keywords: Anti-HCN2, Anti-BCNG2, Anti-BCNG-2, Anti-Brain cyclic nucleotide-gated channel 2, Anti-Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2, HCN2 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32802

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: mouse, rat
Immunogen: Amino acids 682-714 (VFNNQENAIIQEIVKYDREMVQQAELGQRVGLF) from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-HCN2"
Write a review
or to review a product.
Viewed