Anti-GUK1 (Guanylate Kinase, GMP Kinase, GMK)

Guanylate kinase catalyzes the transfer of phosphate from adenosine triphosphate (ATP) to guanosine monophosphate (GMP) or dGMP. This enzyme functions in the recovery of cGMP and is, therefore, thought to regulate the supply of guanine nucleotides to signal transduction pathways. The GUK2 and GUK3 isoforms are determined by separate loci. Brady et al. (1996) cloned human and mouse cDNAs of GUK1. They stated that the guanylate kinases are targets for cancer chemotherapy and are inhibited by the antitumor drug 6-thioguanine. They reported that the human gene codes for a protein of 197aa with a mass of 21.7kD. They found that the 1-kb message was ubiquitously expressed. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.