Anti-GUCA2B (Guanylate Cyclase Activator 2B, Guanylate Cyclase C-activating Peptide 2, Guanylate Cyc

Uroguanylin and guanylin (GUCA2A, MIM 139392), peptide homologs of the bacterial heat-stable enterotoxins (e.g., the E. coli ST toxin, STa), are endogenous activators of the guanylate cyclase-2C receptor (GUCY2C, MIM 601330), which synthesizes cyclic GMP (cGMP), a key component of several intracellular signal transduction pathways. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGCRAASGLLPGVAVVLLLLLQSTQSVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.