Anti-GSTM1, clone 11F2

Anti-GSTM1, clone 11F2
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4483 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Glutathione S-transferase Mu 1 (gene name... more
Product information "Anti-GSTM1, clone 11F2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Glutathione S-transferase Mu 1 (gene name GSTM1) is a human glutathione S-transferase. Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Null mutations of this class mu gene have been linked with an increase in a number of cancers, likely due to an increased susceptibility to environmental toxins and carcinogens. Multiple protein isoforms are encoded by transcript variants of this gene. Protein function: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. [The UniProt Consortium]
Keywords: Anti-GTH4, Anti-GST1, Anti-GSTM1, Anti-GSTM1-1, Anti-GSTM1b-1b, Anti-GSTM1a-1a, EC=2.5.1.18, Anti-GST class-mu 1, Anti-GST HB subunit 4, Anti-Glutathione S-transferase Mu 1, GSTM1 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4483

Properties

Application: FC, IHC (paraffin), WB
Antibody Type: Monoclonal
Clone: 11F2
Conjugate: No
Host: Mouse
Species reactivity: human, mouse, rat
Immunogen: Amino acids EEEKIRVDILENQTMDNHMQLGMICYNPEFEKLK
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-GSTM1, clone 11F2"
Write a review
or to review a product.
Viewed