Anti-GSTM1

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58780.50	50 µg		-	-	6 - 14 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Conjugation of reduced glutathione to a wide number of exogenous and endogenous... more

Close menu

Product information "Anti-GSTM1"

Protein function: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. [The UniProt Consortium]

Keywords:	Anti-GTH4, Anti-GST1, Anti-GSTM1, Anti-GSTM1-1, Anti-GSTM1a-1a, Anti-GSTM1b-1b, EC=2.5.1.18, Anti-GST class-mu 1, Anti-GST HB subunit 4, Anti-Glutathione S-transferase Mu 1
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58780

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	mouse, rat (Expected: human)
Immunogen:	Synthetic peptide corresponding to a sequence of Human GSTM1 (EEEKIRVDILENQTMDNHMQLGMICYNPEFEKLK)
MW:	25 kD
Format:	Antigen Affinity Purified