Anti-GRK6

Anti-GRK6
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32102 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. G protein-coupled receptor kinase 6 is an... more
Product information "Anti-GRK6"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. G protein-coupled receptor kinase 6 is an enzyme that in humans is encoded by the GRK6 gene. It is mapped to 5q35. This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. Several transcript variants encoding different isoforms have been described for this gene. Also, GRK6 appears to be involved in responses tomorphine. Protein function: Specifically phosphorylates the activated forms of G protein-coupled receptors. Such receptor phosphorylation initiates beta-arrestin-mediated receptor desensitization, internalization, and signaling events leading to their desensitization. Seems to be involved in the desensitization of D2-like dopamine receptors in striatum and chemokine receptor CXCR4 which is critical for CXCL12-induced cell chemotaxis. Phosphorylates rhodopsin (RHO) (in vitro) and a non G-protein-coupled receptor: LRP6 during Wnt signaling (in vitro). [The UniProt Consortium]
Keywords: Anti-GRK6, Anti-GPRK6, EC=2.7.11.16, Anti-G protein-coupled receptor kinase 6, Anti-G protein-coupled receptor kinase GRK6, GRK6 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32102

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat
Immunogen: Amino acids QSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQAR of human GRK6 were used as the immunogen for the GRK6 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-GRK6"
Write a review
or to review a product.
Viewed