Anti-GRK3 / ADRBK2

Anti-GRK3 / ADRBK2
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32079 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Beta-adrenergic receptor kinase 2... more
Product information "Anti-GRK3 / ADRBK2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Beta-adrenergic receptor kinase 2 (beta-ARK-2), also known as G-protein-coupled receptor kinase 3 (GRK3), is an enzyme that in humans is encoded by the ADRBK2 gene. The human ADRBK2 gene is located on 22q11. The beta-adrenergic receptor kinase specifically phosphorylates the agonist-occupied form of the beta-adrenergic and related G protein-coupled receptors. Overall, the beta adrenergic receptor kinase 2 has 85% amino acid similarity with beta adrenergic receptor kinase 1, with the protein kinase catalytic domain having 95% similarity. These data suggest the existence of a family of receptor kinases which may serve broadly to regulate receptor function. Protein function: Specifically phosphorylates the agonist-occupied form of the beta-adrenergic and closely related receptors. [The UniProt Consortium]
Keywords: Anti-BARK2, Anti-ADRBK2, Anti-Beta-ARK-2, EC=2.7.11.15, Anti-Beta-adrenergic receptor kinase 2, Anti-G-protein-coupled receptor kinase 3, GRK3 Antibody / ADRBK2
Supplier: NSJ Bioreagents
Supplier-Nr: R32079

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids ESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPR of human GRK3/ADRBK2 were used as the immunogen for the GRK3 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-GRK3 / ADRBK2"
Write a review
or to review a product.
Viewed